PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_86FF10C36.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 441aa    MW: 47637.1 Da    PI: 7.9781
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_86FF10C36.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-39102161261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k+ 
  Traes_4AS_86FF10C36.1 102 PDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSL 161
                            7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3298159IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MGQLRAAPGG GGDCLIKLFG KTIPVPDAGD KVGAHDLQHR GSSATAEPKV QEIAPQDSTG  60
SPPQQPEVVD VEDPSAAKNS AADQQDEEQG DTANQKEKLK KPDKILPCPR CSSMDTKFCY  120
YNNYNINQPR HFCKNCQRYW TAGGAMRNVP VGAGRRKSKS LSAASHFLQR IRAALPGDPL  180
CTPVNTNGTV LSFGSDASTL DVSEQMKHIK DLSSVTRTEN TDAPSVGSSA EGWAKGEESS  240
QMNPRERVAA DRSANFVQHP CMNGAAMWPF SCAPPPAYFP SNVAIPFYPA AAAAYWGCMV  300
PGAWNTPWQP QPQPQPQSQC QSSSPPSAAS PVSTMSSCFQ SRKHPRDGDE ERDTKGNGKV  360
WVPKTIRIDD VDEVARSSIW SLIGIKGDKE EKDDGKGCKL ARVFDPKDEA KTSSHRGNNS  420
LPFLKGNPAA LSRSVNFHER S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2529240.0AK252924.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf174o03, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558722.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLW5DYD70.0W5DYD7_WHEAT; Uncharacterized protein
STRINGMLOC_7224.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-57cycling DOF factor 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]